PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr11P20960_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 247aa    MW: 27539.1 Da    PI: 8.579
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr11P20960_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.55.5e-1979133256
                             T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                             rk+ +++k+q  +Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  GSMUA_Achr11P20960_001  79 RKKLRLSKDQSAILEESFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 133
                             677889***********************************************98 PP

2HD-ZIP_I/II123.97.6e-4079168191
             HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeL 87 
                             +kk+rlsk+q+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e L+r+++ l+een+rL+kev eL
  GSMUA_Achr11P20960_001  79 RKKLRLSKDQSAILEESFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCELLRRCCQDLTEENRRLQKEVLEL 165
                             69************************************************************************************* PP

             HD-ZIP_I/II  88 reel 91 
                             r +l
  GSMUA_Achr11P20960_001 166 R-AL 168
                             9.54 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046183.2E-82359IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.606.4E-1850136IPR009057Homeodomain-like
SuperFamilySSF466891.88E-1870136IPR009057Homeodomain-like
PROSITE profilePS5007116.94175135IPR001356Homeobox domain
SMARTSM003899.3E-1777139IPR001356Homeobox domain
PfamPF000462.0E-1679133IPR001356Homeobox domain
CDDcd000861.09E-1579136No hitNo description
PROSITE patternPS000270110133IPR017970Homeobox, conserved site
PfamPF021833.7E-9135169IPR003106Leucine zipper, homeobox-associated
SMARTSM003406.1E-24135178IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MYILLSTGLE IVYCMHAESR PILDVNQAPS AAAGRNSEED GGVSSPNSRA SSATAKRSTE  60
REAGSRGVSD EEDDGDGCRK KLRLSKDQSA ILEESFKEHS TLNPKQKLAL AKQLNLRPRQ  120
VEVWFQNRRA RTKLKQTEVD CELLRRCCQD LTEENRRLQK EVLELRALKL SPQLYMHMTP  180
PTTLTLCPSC ERACGSTSAA LAAASSSSRN QPPAEYHQFL HQQRPVAAPW APIQLRPSFL  240
DAPPQRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1127135RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009384460.10.0PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotQ054665e-81HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLM0RU260.0M0RU26_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P20960_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25873889
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.13e-59homeobox protein 2